Antibodies

Jump to Filters
View as table Download
CARS1 Rabbit Polyclonal Antibody
TA345737

USD 539.00

5 Days

Rabbit Polyclonal Anti-CARS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CARS antibody: synthetic peptide directed towards the C terminal of human CARS. Synthetic peptide located within the following region: KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD
CARS1 Rabbit Polyclonal Antibody
TA345738

USD 539.00

5 Days

Rabbit Polyclonal Anti-CARS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CARS antibody: synthetic peptide directed towards the N terminal of human CARS. Synthetic peptide located within the following region: MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY
CARS1 Rabbit Polyclonal Antibody
TA374271

USD 365.00

3 Weeks

CARS Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 469-748 of human CARS (NP_001742.1).
Modifications Unmodified
CARS1 Rabbit Polyclonal Antibody
TA345739

USD 539.00

5 Days

Rabbit Polyclonal Anti-CARS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CARS antibody: synthetic peptide directed towards the N terminal of human CARS. Synthetic peptide located within the following region: MQTPPLQQPHQEQVFLAFLVIVIPSFLTKEVFIPQDGKKVTWYCCGPTVY