Rabbit Polyclonal Anti-SI Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SI Antibody: synthetic peptide directed towards the N terminal of human SI. Synthetic peptide located within the following region: NSVLFTTQNQTPNRFRFKITDPNNRRYEVPHQYVKEFTGPTVSDTLYDVK |
Rabbit Polyclonal Anti-SI Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SI Antibody: synthetic peptide directed towards the middle region of human SI. Synthetic peptide located within the following region: LPCQEPAQNTFYSRQKHMKLIVAADDNQMAQGSLFWDDGESIDTYERDLY |
Germany
Japan
United Kingdom
China