Antibodies

View as table Download

UQCRFS1 mouse monoclonal antibody,clone OTI4H8

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) UQCRFS1 mouse monoclonal antibody,clone OTI4H8

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated

UQCRFS1 mouse monoclonal antibody,clone OTI4H8, Biotinylated

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Biotin

UQCRFS1 mouse monoclonal antibody,clone OTI4H8, HRP conjugated

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation HRP

UQCRFS1 mouse monoclonal antibody,clone OTI4H8

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

UQCRFS1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 188-217 amino acids from the C-terminal region of human UQCRFS1

Rabbit Polyclonal antibody to UQCRFS1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1)

Applications IF, WB
Reactivities Human, Mouse (Predicted: Rat, Cow)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 274 of UQCRFS1 (Uniprot ID#P47985)

Rabbit Polyclonal Anti-UQCRFS1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRFS1 antibody: synthetic peptide directed towards the N terminal of human UQCRFS1. Synthetic peptide located within the following region: MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL