Antibodies

Jump to Filters
View as table Download
OR51S1 (C-term) Rabbit Polyclonal Antibody
AP53074PU-N

USD 580.00

2 Weeks

OR51S1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 212-241 amino acids from the C-terminal region of human Olfactory receptor 51S1
OR51S1 Rabbit Polyclonal Antibody
TA316041

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR51S1 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR51S1.
OR51S1 Rabbit Polyclonal Antibody
TA332306

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR51S1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR51S1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR51S1. Synthetic peptide located within the following region: LDPLLIFFSYGLIGKVLQGVESREDRWKAGQTCAAHLSAVLLFYIPMILL