Antibodies

Jump to Filters
View as table Download
OR8G1 Rabbit Polyclonal Antibody
TA315328

USD 380.00

In Stock

Rabbit polyclonal anti-OR8G1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR8G1.
OR8G1 Rabbit Polyclonal Antibody
TA332343

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR8G1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR8G1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR8G1. Synthetic peptide located within the following region: EGRSKAFSTCSSHMLAVVIFFGSAAFMYLQPSSISSMDQGKVSSVFYTII