Antibodies

Jump to Filters
View as table Download
OR4L1 Rabbit Polyclonal Antibody
TA316064

USD 380.00

In Stock

Rabbit polyclonal anti-OR4L1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR4L1.
OR4L1 (C-term) Rabbit Polyclonal Antibody
AP53062PU-N

USD 580.00

2 Weeks

OR4L1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 282-312 amino acids from the C-terminal region of human Olfactory receptor 4L1
OR4L1 Rabbit Polyclonal Antibody
TA337511

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR4L1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR4L1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4L1. Synthetic peptide located within the following region: CIFIYVWPFSSLASNKTLAVFYTVITPLLNPSIYTLRNKKMQEAIRKLRF