Antibodies

Jump to Filters
View as table Download
GPAA1 (N-term) Rabbit Polyclonal Antibody
AP51898PU-N

USD 580.00

2 Weeks

GPAA1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 49-77 amino acids from the N-terminal region of human GPAA1
GPAA1 Rabbit Polyclonal Antibody
TA339374

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPAA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPAA1 antibody: synthetic peptide directed towards the C terminal of human GPAA1. Synthetic peptide located within the following region: LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL