PPP1R17 mouse monoclonal antibody,clone OTI2E5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PPP1R17 mouse monoclonal antibody,clone OTI2E5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
C7ORF16 mouse monoclonal antibody,clone OTI2A8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPP1R17 mouse monoclonal antibody,clone OTI2E5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C7ORF16 mouse monoclonal antibody,clone OTI2A8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
PPP1R17 mouse monoclonal antibody,clone OTI2E5, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
PPP1R17 mouse monoclonal antibody,clone OTI2E5, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
C7ORF16 mouse monoclonal antibody,clone OTI2A8, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
C7ORF16 mouse monoclonal antibody,clone OTI2A8, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-C7orf16 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C7orf16 antibody: synthetic peptide directed towards the middle region of human C7orf16. Synthetic peptide located within the following region: IKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEH |
PPP1R17 mouse monoclonal antibody,clone OTI2E5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
C7ORF16 mouse monoclonal antibody,clone OTI2A8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".