Antibodies

View as table Download

PPP1R17 mouse monoclonal antibody,clone OTI2E5

Applications WB
Reactivities Human
Conjugation Unconjugated

C7ORF16 mouse monoclonal antibody,clone OTI2A8

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP1R17 mouse monoclonal antibody,clone OTI2E5

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C7ORF16 mouse monoclonal antibody,clone OTI2A8

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-C7orf16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C7orf16 antibody: synthetic peptide directed towards the middle region of human C7orf16. Synthetic peptide located within the following region: IKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEH