Rabbit Polyclonal Anti-ARPC1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARPC1B antibody is: synthetic peptide directed towards the middle region of Human ARPC1B. Synthetic peptide located within the following region: KKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGS |
ARPC1B (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human ARPC1B |
Goat Polyclonal Antibody against ARPC1B
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AYHSFLVEPISCH, from the N Terminus of the protein sequence according to NP_005711. |
Rabbit Polyclonal Anti-ARPC1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARPC1B antibody is: synthetic peptide directed towards the C-terminal region of Human ARPC1B. Synthetic peptide located within the following region: RERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTT |
Germany
Japan
United Kingdom
China