Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ADRBK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRBK1 antibody: synthetic peptide directed towards the N terminal of human ADRBK1. Synthetic peptide located within the following region: PEPSIRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRDFCLNHLEEARPLVE |
Rabbit polyclonal ARBK1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ARBK1. |
ADRBK1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ADRBK1 |
Goat Polyclonal Antibody against ADRBK1
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RDAYREAQQLVQR, from the internal region of the protein sequence according to NP_001610.1. |
Rabbit Polyclonal Anti-ADRBK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRBK1 antibody: synthetic peptide directed towards the C terminal of human ADRBK1. Synthetic peptide located within the following region: ILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPL |
Active filters
Category
- Antibodies
Target Symbol
- GRK2
Reactivities
- Human
Pathways
- Endocytosis