ETV7 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ETV7 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ETV7 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETV7 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETV7 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ETV7 mouse monoclonal antibody,clone 3B2, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
ETV7 mouse monoclonal antibody,clone 3B2, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
ETV7 mouse monoclonal antibody,clone 2A10, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
ETV7 mouse monoclonal antibody,clone 2A10, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit Polyclonal Anti-ETV7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ETV7 |
ETV7 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-ETV7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ETV7 Antibody: synthetic peptide directed towards the N terminal of human ETV7. Synthetic peptide located within the following region: SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRAL |
Rabbit Polyclonal Anti-ETV7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ETV7 antibody: synthetic peptide directed towards the C terminal of human ETV7. Synthetic peptide located within the following region: IIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEIS |
ETV7 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".