Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 8 of 8 results

(reset)

Lysyl tRNA synthetase (KARS) Mouse Monoclonal Antibody [Clone ID: OTI1E7]

TA812796

USD 447.00

In Stock

KARS mouse monoclonal antibody,clone OTI1E7

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Lysyl tRNA synthetase (KARS) Mouse Monoclonal Antibody [Clone ID: OTI1E7]

CF812796

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) KARS mouse monoclonal antibody,clone OTI1E7

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Lysyl tRNA synthetase (KARS) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E7]

TA812796AM

USD 509.00

2 Weeks

KARS mouse monoclonal antibody,clone OTI1E7, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Lysyl tRNA synthetase (KARS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E7]

TA812796BM

USD 509.00

2 Weeks

KARS mouse monoclonal antibody,clone OTI1E7, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Lysyl tRNA synthetase (KARS) Mouse Monoclonal Antibody [Clone ID: OTI1E7]

TA812796S

USD 200.00

2 Days

KARS mouse monoclonal antibody,clone OTI1E7

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Lysyl tRNA synthetase (KARS) Rabbit Polyclonal Antibody

TA350109

USD 380.00

In Stock

Rabbit Polyclonal Anti-KARS Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human KARS

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Lysyl tRNA synthetase (KARS) (N-term) Rabbit Polyclonal Antibody

AP52290PU-N

USD 580.00

2 Weeks

Lysyl tRNA synthetase (KARS) (N-term) rabbit polyclonal antibody, Purified

Applications	FC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	KLH conjugated synthetic peptide between 77-105 amino acids from the N-terminal region of human KARS

1 / 3

2 / 3

3 / 3

Previous Next

Lysyl tRNA synthetase (KARS) Rabbit Polyclonal Antibody

TA345923

USD 539.00

5 Days

Rabbit Polyclonal Anti-KARS Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-KARS antibody: synthetic peptide directed towards the C terminal of human KARS. Synthetic peptide located within the following region: GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV

1 / 2

2 / 2

Previous Next

1 - 8 of 8 results