Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 8 of 8 results

(reset)

Adenylosuccinate Lyase (ADSL) Mouse Monoclonal Antibody [Clone ID: OTI2D10]

TA501810

USD 447.00

In Stock

ADSL (Adenylosuccinate Lyase) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications	FC, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Adenylosuccinate Lyase (ADSL) Mouse Monoclonal Antibody [Clone ID: OTI2D10]

CF501810

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) ADSL mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications	FC, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Adenylosuccinate Lyase (ADSL) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D10]

TA501810AM

USD 509.00

2 Weeks

ADSL (Adenylosuccinate Lyase) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10), Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Biotin

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Adenylosuccinate Lyase (ADSL) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D10]

TA501810BM

USD 509.00

2 Weeks

ADSL (Adenylosuccinate Lyase) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10), HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	HRP

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Adenylosuccinate Lyase (ADSL) Mouse Monoclonal Antibody [Clone ID: OTI2D10]

TA501810S

USD 200.00

2 Days

ADSL (Adenylosuccinate Lyase) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications	FC, IHC, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Adenylosuccinate Lyase (ADSL) Rabbit Polyclonal Antibody

TA323761

USD 380.00

In Stock

Anti-ADSL Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 250 amino acids of human adenylosuccinate lyase

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Adenylosuccinate Lyase (ADSL) Rabbit Polyclonal Antibody

TA342801

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADSL Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ADSL antibody: synthetic peptide directed towards the middle region of human ADSL. Synthetic peptide located within the following region: RVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFI

1 / 3

2 / 3

3 / 3

Previous Next

Adenylosuccinate Lyase (ADSL) Rabbit Polyclonal Antibody

TA361952

USD 539.00

5 Days

ADSL Antibody - middle region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human ADSL

1 - 8 of 8 results