PARVB mouse monoclonal antibody,clone 2H1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PARVB mouse monoclonal antibody,clone 2H1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PARVB mouse monoclonal antibody,clone 2H1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PARVB mouse monoclonal antibody,clone 2H9, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PARVB mouse monoclonal antibody,clone 2H9, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PARVB mouse monoclonal antibody,clone 3G1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PARVB mouse monoclonal antibody,clone 3G1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) PARVB mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PARVB mouse monoclonal antibody,clone 2B4, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PARVB mouse monoclonal antibody,clone 2B4, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PARVB mouse monoclonal antibody,clone OTI1B7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PARVB mouse monoclonal antibody, clone OTI1B9 (formerly 1B9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PARVB mouse monoclonal antibody,clone OTI2H1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PARVB mouse monoclonal antibody,clone OTI2H9
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PARVB mouse monoclonal antibody,clone OTI3G1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-PARVB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PARVB antibody: synthetic peptide directed towards the N terminal of human PARVB. Synthetic peptide located within the following region: LQEEGKNAINSPMSPALVDVHPEDTQLEENEERTMIDPTSKEDPKFKELV |