Rabbit Polyclonal Anti-GOT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Rat, Gibbon, Hamster, Orang-Utan (Predicted: Monkey, Goat, Pig) |
| Conjugation | Unconjugated |
| Immunogen | Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%). |
PAH mouse monoclonal antibody,clone OTI4F6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
PAH mouse monoclonal antibody,clone OTI8A7
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Goat Polyclonal Antibody against GOT1 (Internal region)
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSYRYWDAEKR, from the internal region of the protein sequence according to NP_002070.1. |
Rabbit polyclonal anti-IL4I1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human IL4I1. |
Rabbit anti-GOT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GOT1 |
Rabbit Polyclonal TAT Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Goat Anti-Phenylalanine Hydroxylase (PAH) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ESRPSRLKKDE, from the internal region of the protein sequence according to NP_000268.1. |
USD 580.00
2 Weeks
Aspartate Aminotransferase (GOT1) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human GOT1 |
Goat Polyclonal Antibody against GOT1
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TADFREDPDPRKVN, from the internal region of the protein sequence according to NP_002070.1. |
Goat Polyclonal Antibody against GOT2
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNLKKEGSTHNWQH, from the internal region of the protein sequence according to NP_002071.2. |
Goat Polyclonal Antibody against GOT2 (Internal Region)
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CKDADEAKRVES, from the internal region of the protein sequence according to NP_002071.2. |
Germany
Japan
United Kingdom
China
