Carrier-free (BSA/glycerol-free) POLR2H mouse monoclonal antibody,clone OTI1H2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR2H mouse monoclonal antibody,clone OTI1H2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR2H mouse monoclonal antibody,clone OTI5A1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLR2H mouse monoclonal antibody,clone OTI3C10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
POLR2H mouse monoclonal antibody,clone OTI1H2, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
POLR2H mouse monoclonal antibody,clone OTI1H2, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
POLR2H mouse monoclonal antibody,clone OTI5A1, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
POLR2H mouse monoclonal antibody,clone OTI5A1, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
POLR2H mouse monoclonal antibody,clone OTI3C10, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
POLR2H mouse monoclonal antibody,clone OTI3C10, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
POLR2H mouse monoclonal antibody,clone OTI1C10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
POLR2H mouse monoclonal antibody,clone OTI4A12
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
POLR2H mouse monoclonal antibody,clone OTI6E10
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal antibody to RPB8 (polymerase (RNA) II (DNA directed) polypeptide H)
Applications | WB |
Reactivities | Human (Predicted: Mouse, Rat, Pig, Chicken, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of RPB8 (Uniprot ID#P52434) |
Rabbit Polyclonal Anti-POLR2H Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR2H antibody: synthetic peptide directed towards the N terminal of human POLR2H. Synthetic peptide located within the following region: DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE |
POLR2H mouse monoclonal antibody,clone OTI1H2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".