Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal CARD9 Antibody
| Applications | ELISA, ICC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CARD9 antibody was raised against a synthetic peptide corresponding to amino acids 521 to 536 of human CARD9 The sequence is different from that of rat origin by two amino acids. |
Rabbit Polyclonal Anti-CARD9 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CARD9 antibody: synthetic peptide directed towards the middle region of human CARD9. Synthetic peptide located within the following region: ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR |
