Antibodies

Jump to Filters
View as table Download
TPCN1 Rabbit Polyclonal Antibody
TA338582

USD 539.00

5 Days

Rabbit Polyclonal Anti-TPCN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPCN1 antibody: synthetic peptide directed towards the N terminal of human TPCN1. Synthetic peptide located within the following region: YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL
TPCN1 Rabbit Polyclonal Antibody
TA382746

USD 365.00

3 Weeks

TPCN1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 692-816 of human TPCN1 (NP_060371.2).
Modifications Unmodified