Rabbit Polyclonal Anti-GJB4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GJB4 |
Rabbit Polyclonal Anti-GJB4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GJB4 |
GJB4 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human GJB4 |
Rabbit Polyclonal Anti-GJB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GJB4 antibody: synthetic peptide directed towards the middle region of human GJB4. Synthetic peptide located within the following region: CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL |