Rabbit Polyclonal Anti-SPIRE2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SPIRE2 |
Rabbit Polyclonal Anti-SPIRE2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SPIRE2 |
Rabbit Polyclonal Anti-SPIRE2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPIRE2 antibody: synthetic peptide directed towards the N terminal of human SPIRE2. Synthetic peptide located within the following region: EAQTVQSLGFAIYRALDWGLDESEERELSPQLERLIDLMANNDSEDSGCG |
SPIRE2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human SPIRE2 (NP_115827.1). |
Modifications | Unmodified |