Antibodies

Jump to Filters
View as table Download
CD82 Rabbit Polyclonal Antibody
TA332430

USD 365.00

3 Weeks

Rabbit anti-CD82 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CD82
CD82 (C-term) Rabbit Polyclonal Antibody
AP23396PU-N

USD 560.00

2 Weeks

CD82 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human CD82
CD82 Rabbit Polyclonal Antibody
TA343300

USD 539.00

5 Days

Rabbit Polyclonal Anti-CD82 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD82 antibody is: synthetic peptide directed towards the middle region of CD82. Synthetic peptide located within the following region: ELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTY