Anti-RAP1A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-RAP1A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-RAP1A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit polyclonal antibody to RAP1A (RAP1A, member of RAS oncogene family)
Applications | WB |
Reactivities | Human (Predicted: Rat, Bovine, Rhesus Monkey, Mouse) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 134 of RAP1 (Uniprot ID#P62834) |
Rabbit Polyclonal Anti-RAP1A Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rap1a antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rap1a. Synthetic peptide located within the following region: GQNLARQWCNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKPKKKS |
Rabbit Polyclonal Anti-Rap1a Antibody
Reactivities | Mouse |
Conjugation | Unconjugated |