Germany
Japan
United Kingdom
China
Rabbit Polyclonal Speedy/Ringo Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SPDYA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPDYA Antibody: synthetic peptide directed towards the N terminal of human SPDYA. Synthetic peptide located within the following region: MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNT |
Rabbit Polyclonal Anti-SPDYA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPDYA Antibody: synthetic peptide directed towards the middle region of human SPDYA. Synthetic peptide located within the following region: HTAGVTEKHSQDSYNSLSMDIIGDPSQAYTGSEVVNDHQSNKGKKTNFLK |
