Antibodies

Jump to Filters
View as table Download
OR2B2 Rabbit Polyclonal Antibody
TA315858

USD 380.00

In Stock

Rabbit polyclonal anti-OR2B2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2B2.
OR2B2 Rabbit Polyclonal Antibody
TA342705

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR2B2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR2B2 antibody: synthetic peptide directed towards the C terminal of human OR2B2. Synthetic peptide located within the following region: IAPMLNPLIYTLRNKEVKEAFKRLVAKSLLNQEIRNMQMISFAKDTVLTY