Antibodies

Jump to Filters
View as table Download
NPY1R Rabbit Polyclonal Antibody
TA321232

USD 380.00

4 Weeks

Anti-NPY1R rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of Human neuropeptide Y receptor Y1
NPY1R Rabbit Polyclonal Antibody
TA346235

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-NPY1R Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NPY1R antibody: synthetic peptide directed towards the middle region of human NPY1R. Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI
NPY1R (C-term) Rabbit Polyclonal Antibody
AP23327PU-N

USD 560.00

2 Weeks

NPY1R (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide mapping at the C-terminal of human NPY1R
NPY1R Rabbit Polyclonal Antibody
TA314281

USD 380.00

4 Weeks

Rabbit polyclonal anti-NPY1R antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NPY1R.