Antibodies

Jump to Filters
View as table Download
Metabotropic Glutamate Receptor 7 (GRM7) Rabbit Polyclonal Antibody
TA317617

USD 515.00

5 Days

GRM7 / MGLUR7 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bovine, Human (Predicted: Monkey, Mouse, Rat, Dog, Horse)
Conjugation Unconjugated
Immunogen GRM7 / MGLUR7 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GRM7 / MGLUR7. Percent identity with other species by BLAST analysis: Human, Elephant, Bovine (100%); Chimpanzee, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Dog, Horse (95%); Gibbon, Panda, Rabbit, Opossum (89%); Chicken, Xenopus (84%).
Metabotropic Glutamate Receptor 7 (GRM7) Rabbit Polyclonal Antibody
TA311810

USD 380.00

In Stock

Rabbit polyclonal anti-GRM7 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human GRM7.
Modifications Phospho-specific
Metabotropic Glutamate Receptor 7 (GRM7) Rabbit Polyclonal Antibody
TA311811

USD 380.00

In Stock

Rabbit polyclonal anti-GluR7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GluR7.
Modifications Phospho-specific
Metabotropic Glutamate Receptor 7 (GRM7) Goat Polyclonal Antibody
TA305625

USD 520.00

5 Days

Goat Anti-GRM7 Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence NCKLTISGSKKEDT, from the internal region of the protein sequence according to NP_000835.1; NP_870989.1.
Metabotropic Glutamate Receptor 7 (GRM7) Rabbit Polyclonal Antibody
TA342670

USD 539.00

5 Days

Rabbit Polyclonal Anti-GRM7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRM7 antibody: synthetic peptide directed towards the C terminal of human GRM7. Synthetic peptide located within the following region: HPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS
Metabotropic Glutamate Receptor 7 (GRM7) Rabbit Polyclonal Antibody
TA347392

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-mGluR7 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-mGluR7 Antibody: A synthesized peptide derived from human mGluR7