Rabbit Polyclonal Anti-CARD9 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CARD9 |
Rabbit Polyclonal Anti-CARD9 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CARD9 |
Rabbit Polyclonal Anti-CARD9 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CARD9 antibody: synthetic peptide directed towards the middle region of human CARD9. Synthetic peptide located within the following region: ALHQEQVLRNPHDAGLSSGEPPEKERRRLKESFENYRRKRALRKMQKGWR |