Antibodies

View as table Download

Rabbit anti-ZYX polyclonal antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH

Rabbit Polyclonal Anti-ZYX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZYX Antibody: synthetic peptide directed towards the middle region of human ZYX. Synthetic peptide located within the following region: GSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEV

Rabbit Polyclonal Anti-ZYX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZYX Antibody: synthetic peptide directed towards the middle region of human ZYX. Synthetic peptide located within the following region: QPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPE

Rabbit polyclonal Zyxin (Ser142) antibody(Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Zyxin around the phosphorylation site of serine 142 (K-V-SP-S-I).
Modifications Phospho-specific