Antibodies

Jump to Filters
View as table Download
NCAM2 Rabbit Polyclonal Antibody
TA314232

USD 380.00

4 Weeks

Rabbit polyclonal anti-NCAM2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NCAM2.
NCAM2 Rabbit Polyclonal Antibody
TA339422

USD 539.00

5 Days

Rabbit Polyclonal Anti-NCAM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NCAM2 antibody: synthetic peptide directed towards the middle region of human NCAM2. Synthetic peptide located within the following region: KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL