Rabbit Polyclonal Anti-IFNA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNA4 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNA4. Synthetic peptide located within the following region: ILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD |
Rabbit Polyclonal Anti-ATG4C Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4C antibody: synthetic peptide directed towards the middle region of human ATG4C. Synthetic peptide located within the following region: TISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKS |
Rabbit Polyclonal Anti-ATG4B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4B antibody: synthetic peptide directed towards the N terminal of human ATG4B. Synthetic peptide located within the following region: WGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDS |
Rabbit Polyclonal Anti-ATG4B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG4B Antibody: A synthesized peptide derived from human ATG4B |
Rabbit Polyclonal Anti-Beclin 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Beclin 1 Antibody: A synthesized peptide derived from human Beclin 1 |
Rabbit Polyclonal Anti-Interferon gamma Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interferon gamma Antibody: A synthesized peptide derived from human Interferon gamma |
Goat Polyclonal Anti-FCRL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FCRL1 Antibody: Peptide with sequence C-SRLRKANITDVD, from the C Terminus of the protein sequence according to NP_443170.1; NP_001152870.1. |
Rabbit anti AMPKa(pS79) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -CGSPN- with a phosphorylation site at Ser79 of AMPK alpha 1 protein from Carassius Auratus origin. This sequence is identical among human, mouse, rat, chicken, bovine, dog, and insect species. |
Rabbit anti AMPK-alpha(pT172) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog, Invertebrate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Rabbit anti AMPK-alpha Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog, Invertebrate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Rabbit Polyclonal AMPK1 Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK1 |
PRKAA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRKAA1 |
Phospho-PRKAA1-T174/T172 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T174/T172 of human PRKAA1 |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China