Antibodies

Jump to Filters
View as table Download
RFT1 (C-term) Rabbit Polyclonal Antibody
AP53640PU-N

USD 580.00

2 Weeks

RFT1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 520-549 amino acids from the C-terminal region of Human RFT1
RFT1 Rabbit Polyclonal Antibody
TA342065

USD 539.00

5 Days

Rabbit Polyclonal Anti-RFT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFT1 antibody: synthetic peptide directed towards the N terminal of human RFT1. Synthetic peptide located within the following region: GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV