Rabbit Polyclonal Anti-ChGn Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ChGn antibody: synthetic peptide directed towards the C terminal of human ChGn. Synthetic peptide located within the following region: DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT |
Rabbit polyclonal CSGALNACT1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CSGALNACT1. |
Rabbit Polyclonal Anti-CSGALNACT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSGALNACT1 antibody: synthetic peptide directed towards the N terminal of human CSGALNACT1. Synthetic peptide located within the following region: KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE |
Germany
Japan
United Kingdom
China
