Antibodies

View as table Download

Anti-LAMP3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 51-66 amino acids of Human lysosomal-associated membrane protein 3

Anti-LAMP3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 51-66 amino acids of Human lysosomal-associated membrane protein 3

Rabbit polyclonal LAMP3 Antibody (N-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This LAMP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 8-38 amino acids from the N-terminal region of human LAMP3.

Rabbit polyclonal anti-LAMP3 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LAMP3.

Rabbit Polyclonal Anti-LAMP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMP3 antibody: synthetic peptide directed towards the N terminal of human LAMP3. Synthetic peptide located within the following region: YSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPT