Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-OLR1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2-15 amino acids of Human oxidized low density lipoprotein (lectin-like) receptor 1 |
Rabbit Polyclonal Anti-ACSL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI |
Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4). |
Rabbit Polyclonal Anti-ACSL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the C terminal of human ACSL1. Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG |
Rabbit Polyclonal Anti-SLC27A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC27A2 Antibody: synthetic peptide directed towards the N terminal of human SLC27A2. Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW |
Mouse anti-SCD1 (Stearoyl-CoA desaturase) monoclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA309938 is a replacement of AM20836PU-N.
Active filters
Category
- Antibodies
Isotypes
- IgG
Families
- Transmembrane
Pathways
- PPAR signaling pathway