Antibodies

Jump to Filters
View as table Download
OR2AG1 Rabbit Polyclonal Antibody
TA316140

USD 380.00

4 Weeks

Rabbit polyclonal OR2AG1/2AG2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2AG1.
OR2AG1 Rabbit Polyclonal Antibody
TA334153

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR2AG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2AG1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR2AG1. Synthetic peptide located within the following region: LAAILASYTQILLTVLHMPSNEGRKKALVTCSSHLTVVGMFYGAATFMYV