Rabbit Polyclonal Anti-GRIK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRIK2 antibody: synthetic peptide directed towards the C terminal of human GRIK2. Synthetic peptide located within the following region: TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKIST |
Rabbit anti-GRIK2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRIK2 |
Rabbit Polyclonal Anti-GRIK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRIK2 antibody: synthetic peptide directed towards the N terminal of human GRIK2. Synthetic peptide located within the following region: LSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLP |
Rabbit Polyclonal Grik2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Grik2 antibody was raised against a 13 amino acid peptide near the carboxy terminus of the human Grik2. |
Rabbit anti GluR6/7 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China