Rabbit polyclonal SGCG Antibody (Center)
| Applications | WB |
| Reactivities | Human (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This SGCG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 145-172 amino acids from the Central region of human SGCG. |
Rabbit Polyclonal Anti-SGCG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGCG antibody: synthetic peptide directed towards the middle region of human SGCG. Synthetic peptide located within the following region: FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS |
Germany
Japan
United Kingdom
China