Antibodies

View as table Download

Rabbit Polyclonal Anti-ZBTB10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZBTB10 Antibody: synthetic peptide directed towards the N terminal of human ZBTB10. Synthetic peptide located within the following region: SAWPPQPQPRQPPPPAPPALQPPNGRGADEEVELEGLEPQDLEASAGPAA

ZBTB10 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 560-590 amino acids from the C-terminal region of human ZBTB10

Rabbit Polyclonal Anti-ZBTB10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZBTB10 antibody: synthetic peptide directed towards the middle region of human ZBTB10. Synthetic peptide located within the following region: GGQEGVDQGQDTEFPRDEEYEENEVGEADEELVDDGEDQNDPSRWDESGE