Germany
Japan
United Kingdom
China
SSX1 mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)
| Applications | FC, IF, WB |
| Reactivities | Human, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Antibodies
View as table DownloadSSX1 mouse monoclonal antibody, clone OTI2D12 (formerly 2D12)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SSX1 mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SSX1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-SSX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SSX1 |
SSX1 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-SSX1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SSX1 antibody: synthetic peptide directed towards the middle region of human SSX1. Synthetic peptide located within the following region: MCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDE |
