Antibodies

Jump to Filters
View as table Download
14 3 3 eta (YWHAH) Rabbit Polyclonal Antibody
TA330344

USD 539.00

5 Days

Rabbit Polyclonal Anti-YWHAH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-YWHAH antibody: synthetic peptide directed towards the N terminal of human YWHAH. Synthetic peptide located within the following region: ADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKV
14 3 3 eta (YWHAH) Rabbit Polyclonal Antibody
TA314676

USD 380.00

In Stock

Rabbit polyclonal anti-14-3-3 eta antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 14-3-3 ?.