Rabbit polyclonal POLD2 Antibody (Center)
| Applications | WB |
| Reactivities | Human, Rat (Predicted: Mouse, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This POLD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 237-265 amino acids from the Central region of human POLD2. |
Rabbit polyclonal Anti-MRE11A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRE11A antibody: synthetic peptide directed towards the middle region of human MRE11A. Synthetic peptide located within the following region: RFRETRQKNTNEEDDEVREAMTRARALRSQSEESASAFSADDLMSIDLAE |
Rabbit Polyclonal Anti-POLD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLD2 antibody: synthetic peptide directed towards the N terminal of human POLD2. Synthetic peptide located within the following region: LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT |
Rabbit Polyclonal Anti-MRE11A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRE11A Antibody: A synthesized peptide derived from human MRE11A |
Rabbit polyclonal RFA2 (Thr21) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal RFA2 (Ser33) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of serine 33 (A-P-SP-Q-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal RAD51 (Tyr315) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RAD51 around the phosphorylation site of tyrosine 315 (K-I-YP-D-S). |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China