Antibodies

Jump to Filters
View as table Download
VEGFC Rabbit Polyclonal Antibody
TA321716

USD 380.00

2 Weeks

Anti-VEGFC Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 256-270 amino acids of human vascular endothelial growth factor C
VEGFC Rabbit Polyclonal Antibody
TA343278

USD 539.00

5 Days

Rabbit Polyclonal Anti-VEGFC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VEGFC antibody is: synthetic peptide directed towards the C-terminal region of Human VEGFC. Synthetic peptide located within the following region: LDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFD