Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit Polyclonal Anti-NGF beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NGF beta Antibody: A synthesized peptide derived from human NGF beta |
BDNF rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide mapping at the middle region of human BDNF |
Fas Ligand (FASLG) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a sequence mapping at the C-terminal of human FAS-L |
Rabbit polyclonal Anti-Ntf3 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ntf3 antibody is: synthetic peptide directed towards the N-terminal region of Ntf3. Synthetic peptide located within the following region: LAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENY |
Active filters
Category
- Antibodies
Reactivities
- Rat
Isotypes
- IgG
Families
- Secreted Protein
Pathways
- Neurotrophin signaling pathway