Rabbit polyclonal antibody to PPM1K (protein phosphatase 1K (PP2C domain containing))
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Mouse, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 364 of PPM1K (Uniprot ID#Q8N3J5) |
Rabbit Polyclonal Anti-PPM1K Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPM1K antibody: synthetic peptide directed towards the middle region of human PPM1K. Synthetic peptide located within the following region: AHAVTEQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFSRSFASSGRWA |
Germany
Japan
United Kingdom
China
