Antibodies

Jump to Filters
View as table Download
PTPN5 Mouse Monoclonal Antibody
TA309823

USD 550.00

In Stock

Mouse Monoclonal STEP Antibody (23E5)

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PTPN5 Rabbit Polyclonal Antibody
TA350313

USD 380.00

In Stock

Rabbit Polyclonal Anti-PTPN5 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PTPN5
PTPN5 Rabbit Polyclonal Antibody
TA335980

USD 539.00

5 Days

Rabbit Polyclonal Anti-PTPN5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PTPN5 Antibody: synthetic peptide directed towards the middle region of human PTPN5. Synthetic peptide located within the following region: VPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNE