Rabbit Polyclonal Anti-GJA4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GJA4 antibody: synthetic peptide directed towards the middle region of human GJA4. Synthetic peptide located within the following region: QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA |
Rabbit polyclonal anti-GJA4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from nal of human GJA4. |
GJA4 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-GJA4 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GJA4 |
Germany
Japan
United Kingdom
China
