Antibodies

View as table Download

Rabbit Polyclonal Anti-FXYD1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FXYD1

Rabbit Polyclonal Anti-FXYD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FXYD1 antibody: synthetic peptide directed towards the N terminal of human FXYD1. Synthetic peptide located within the following region: ASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILG