Rabbit Polyclonal Anti-GABRA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW |
Rabbit Polyclonal Anti-GABRR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRR2 antibody: synthetic peptide directed towards the middle region of human GABRR2. Synthetic peptide located within the following region: SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY |
Rabbit polyclonal antibody to alpha 2 Glycine Receptor (glycine receptor, alpha 2)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 216 of Glycine Receptor alpha 2 (Uniprot ID#P23416) |
Rabbit polyclonal GABRA2 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This GABRA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 378-406 amino acids from the C-terminal region of human GABRA2. |
Rabbit Polyclonal Anti-GABRD Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD. Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG |
Rabbit Polyclonal Anti-GABRP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRP antibody: synthetic peptide directed towards the N terminal of human GABRP. Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE |
Rabbit Polyclonal Anti-GABRP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRP antibody: synthetic peptide directed towards the N terminal of human GABRP. Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE |
Rabbit Polyclonal Anti-GABRA3 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRA3 antibody: synthetic peptide directed towards the middle region of human GABRA3. Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT |
GABRA2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GABRA2 |
Rabbit Polyclonal Anti-GABRB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRB2 antibody: synthetic peptide directed towards the N terminal of human GABRB2. Synthetic peptide located within the following region: DNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTT |
Germany
Japan
United Kingdom
China
