BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
BCL2A1 (Center) rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 63~92 amino acids from the Center region of human BCL2A1 |
Anti-BCL2A1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-175 amino acids of human BCL2-related protein A1 |
BCL2A1 mouse monoclonal antibody, clone OTI3D10 (formerly 3D10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Goat Anti-BCL2A1 Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Dog, Cow, Pig) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NVVSVDTART, from the internal region of the protein sequence according to NP_004040.1; NP_001108207.1. |
Rabbit Polyclonal Anti-BCL2A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BCL2A1 antibody: synthetic peptide directed towards the C terminal of human BCL2A1. Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY |