Mouse Monoclonal Antibody against NQO1 (A180) - Neuronal Injury Marker
Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal Antibody against NQO1 (A180) - Neuronal Injury Marker
Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Anti-NQO1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 260-274 amino acids of Human NAD(P)H dehydrogenase, quinone 1 |
Rabbit polyclonal antibody to NQO1 (NAD(P)H dehydrogenase, quinone 1)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Pig, Bovine, Guinea Pig, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 213 and 274 of NQO1 (Uniprot ID#P15559) |
Goat Polyclonal Antibody against NQO1
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Dog (Expected from sequence similarity: Rat, Pig) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SIPTDNQIKARK, from the C Terminus of the protein sequence according to NP_000894.1; NP_001020604.1; NP_001020605.1. |
Rabbit polyclonal NQO1 Antibody (Center)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NQO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 118-144 amino acids from the Central region of human NQO1. |
Rabbit Polyclonal NQO-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Canine, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 250-274 of human NQO1 was used as the immunogen. |
Rabbit anti-NQO1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human NQO1 |
Rabbit Polyclonal Anti-NQO1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NQO1 antibody: synthetic peptide directed towards the C terminal of human NQO1. Synthetic peptide located within the following region: WKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVG |
NQO1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |